PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013078.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 377aa    MW: 38723 Da    PI: 9.6672
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013078.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-3984144262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 +e alkcprCdstntkfCyynnyslsqPr+fCkaCrryWt+GG+lrnvPvGgg+r+nk+ss
  Do013078.1  84 PEPALKCPRCDSTNTKFCYYNNYSLSQPRHFCKACRRYWTRGGSLRNVPVGGGCRRNKRSS 144
                 67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3374140IPR003851Zinc finger, Dof-type
PfamPF027013.9E-3387142IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.79588142IPR003851Zinc finger, Dof-type
PROSITE patternPS01361090126IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MVFPSVPPYL DPPNWNNQEQ GQQPRASGGG DAPLLPVGPA AATAAAPDAS GLPSSSSGAS  60
AAMAAQARPN SMAERARLAR MPQPEPALKC PRCDSTNTKF CYYNNYSLSQ PRHFCKACRR  120
YWTRGGSLRN VPVGGGCRRN KRSSKSSSSA AGSSFSSKPS SSARQLGGPS STPSTTPGAT  180
GTIIPPGLGS FSHHLPFLGS MHQPGPNLGL AFSTGLPPLG MQHMDTVDQF PVASGGGATI  240
GASLEQWRVQ QQPQQQFPFL TGGGILEFPP PPMYQLGLDA NRGGSGSAAA DAFTLGQTSA  300
TTARQEGSMK VEDSKGQDMS LQRQYMAALR HGSQGVWEGN AGSSGGGGDG NGGSSWPMNI  360
PGFHSSSTGG GNGSGLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824000.0KC582400.1 Sorghum bicolor dof3 protein (dof3) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984738.11e-176PREDICTED: dof zinc finger protein DOF3.6 isoform X2
TrEMBLK4ABE01e-176K4ABE0_SETIT; Uncharacterized protein
STRINGSi036197m1e-175(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123012432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.14e-38Dof family protein